PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01004298G0140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 555aa    MW: 59669.9 Da    PI: 9.3213
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01004298G0140genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.3e-103323691954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ ++++ LAk++ Lt +qV++WF N R +
  PH01004298G0140 332 FEHflHPYPTDSDKQMLAKQTCLTRNQVSNWFINARVR 369
                      554459******************************87 PP

2BELL95.45.2e-31199268372
             BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      +e q +k++L+sl e V+krYkqy++qlq+vissFe+vagl +a+p++s+Al+++S+hFr Lk +i +q+
  PH01004298G0140 199 AEQQWRKTRLISLTEDVCKRYKQYYQQLQAVISSFETVAGLSNAAPFASMALRTMSKHFRYLKSMILSQL 268
                      58899**************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.2E-36131266IPR006563POX domain
PfamPF075262.5E-36136264IPR006563POX domain
PROSITE profilePS5007111.742310373IPR001356Homeobox domain
CDDcd000868.24E-12313374No hitNo description
SMARTSM003892.2E-8313377IPR001356Homeobox domain
SuperFamilySSF466892.82E-16315380IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-27316377IPR009057Homeodomain-like
PfamPF059206.1E-18330369IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MSSAAGGYGG GAEHQHHLLL GQAAGQLYHV PQHSRREKLR FPPDPADYSP PPGLWPPPPG  60
PFYSNASSYS PHSPTLAHAH AQLVAHGLPG GAQIPSQNFA LSLSSNPPPP ARRPLGVGGG  120
GGATGPYGPF TGYAAVLGRS RFLGPAQKLL EEICDVGGRP AQVHRGSDDG LLDMDAGDVN  180
HEIDGSDRAA AETVTVSGAE QQWRKTRLIS LTEDVCKRYK QYYQQLQAVI SSFETVAGLS  240
NAAPFASMAL RTMSKHFRYL KSMILSQLRN TSKVAAKDGL GKEDMTNFGL MGGGAGLLRG  300
NSVNAFSQPH NIWRPQRGLP ERAVSVLRAW LFEHFLHPYP TDSDKQMLAK QTCLTRNQVS  360
NWFINARVRV WKPMVEEIHN LEMRQLQKNS SRDKNQLGIR QTQHSSDSSG KPSDPSNSQQ  420
GQSSSIPKNH STPASSRHIQ NELPHMPHDI PGQVSFAYNG LAAHHSIALS HPQQVEGVGV  480
GGAANGGGVS LTLGLHQNNR ANIAEPLPAA LPLNLAHRFG LEDVSDAYVL GSFGGQDRHF  540
TKEIGGHLLH DFVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-16319376158Homeobox protein Meis1
4xrs_A3e-16319376158Homeobox protein Meis1
5bng_A3e-16319377159Homeobox protein Meis2
5bng_B3e-16319377159Homeobox protein Meis2
4xrm_B3e-16319377563Homeobox protein Meis2
4xrm_A3e-16319377563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654500.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLJ3M7T00.0J3M7T0_ORYBR; Uncharacterized protein
STRINGOB05G26540.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-66TALE family protein